Pesquisas alternativas:
model compared » model compound (Expandir a Pesquisa), model complex (Expandir a Pesquisa), model combined (Expandir a Pesquisa)
complex can » complex case (Expandir a Pesquisa), complex care (Expandir a Pesquisa), complex cell (Expandir a Pesquisa)
compared a » compared _ (Expandir a Pesquisa), compare a (Expandir a Pesquisa), compare _ (Expandir a Pesquisa)
carlos noe » carlos noel (Expandir a Pesquisa), carlos noa (Expandir a Pesquisa), carlos nojek (Expandir a Pesquisa)
neil cony » neil conway (Expandir a Pesquisa), neil cox (Expandir a Pesquisa)
j model » j modolo (Expandir a Pesquisa), j monder (Expandir a Pesquisa)
a newts » _ newts (Expandir a Pesquisa), a news (Expandir a Pesquisa), a newt (Expandir a Pesquisa)
can now » can new (Expandir a Pesquisa), can non (Expandir a Pesquisa), can ngoc (Expandir a Pesquisa)
A mostrar 1 - 20 resultados de 178 para a pesquisa '(( j model compared a newts ) OR ((( 5 novel complex can now ) OR ( _ neil cony carlos noe ))))', tempo de pesquisa: 2.35seg Refinar resultados
2
Comparison of Buprenorphine and Butorphanol Analgesia in the Eastern Red-Spotted Newt (Notophthalmus viridescens)
Por Koeller, Craig A
Publicado em 2009
“...The experimental use of amphibian models in biomedical research increases yearly, but there is a...”
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
3
Seasonal variation in environmental DNA detection in sediment and water samples.
Por Andrew S Buxton, Jim J Groombridge, Richard A Griffiths
Publicado em 2018-01-01
“... assessment. Using the great crested newt as a model, we compare how detection probability changes across...”
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
4
Seasonal variation in environmental DNA detection in sediment and water samples
“... assessment. Using the great crested newt as a model, we compare how detection probability changes across...”
Obter o texto integral
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
6
Directional instability of kinetochore motility during chromosome congression and segregation in mitotic newt lung cells: a push-pull mechanism
Publicado em 1993
“...Most models of mitotic congression and segregation assume that only poleward pulling forces occur...”
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
7
Lens regeneration from the cornea requires suppression of Wnt/β-catenin signaling
“... regeneration in the newt (Wolffian lens regeneration) has shown a necessity for active Wnt signaling in order...”
Obter o texto integral
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
9
A potential wound-healing-promoting peptide from salamander skin
“...; NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR) in a murine model of full-thickness dermal wound. Tylotoin directly enhances the motility...”
Obter o texto integral
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
10
The septin Sept5/CDCrel-1 competes with α-SNAP for binding to the SNARE complex
“... complexes. Although Sept5 cannot bind an nSec1–syntaxin complex, it can bind syntaxin in a SNARE complex...”
Obter o texto integral
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
11
Functional Imaging in living Plants - Cell Biology meets Physiology
“... processes can be monitored in their natural 3D context, even in complex tissues and organs – a condition...”
Obter o texto integral
Livro
Adic. favoritos
Na minha lista:
13
Degradation of Transcription Factor Rfx5 during the Inhibition of Both Constitutive and Interferon γ–Inducible Major Histocompatibility Complex Class I Expression in Chlamydia-Infected Cells
“... by degrading upstream stimulation factor (USF)-1. We now report that chlamydia can also inhibit both...”
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
14
Systems Biology of Yersinia pestis
Por V. L. Motin
Publicado em 2013-09-01
Assuntos: “...modeling...”
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
19
A novel BDNF gene promoter directs expression to skeletal muscle
Por Heinrich, Gerhard
Publicado em 2003
“... associated promoters, is reported. Among them are two exons that generate a novel tripartite mature...”
Obter o texto integral
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
20
A comprehensive network and pathway analysis of candidate genes in major depressive disorder
“... available during the last decade. It is now a great challenge to assess such heterogeneous datasets...”
Obter o texto integral
Obter o texto integral
Obter o texto integral
Artigo
Adic. favoritos
Na minha lista:
Ferramentas de pesquisa: Obter Feed RSS — Enviar pesquisa por email — Guardar a pesquisa