Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.

A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amin...

Full description

Saved in:
Bibliographic Details
Main Authors: Furuya, K, Schegg, K M, Wang, H, King, D S, Schooley, D A
Format: Artigo
Language:Inglês
Published: 1995
Subjects:
Research Article
Online Access:https://ncbi.nlm.nih.gov/pmc/articles/PMC40349/
https://ncbi.nlm.nih.gov/pubmed/8618894
Tags: Add Tag
No Tags, Be the first to tag this record!

Similar Items