Isolation and identification of a diuretic hormone from the mealworm Tenebrio molitor.

A diuretic hormone of unusual structure was isolated from extracts of whole heads of the mealworm Tenebrio molitor. The hormone is a 37-aa peptide of 4371 Da, with the sequence SPTISITAPIDVLRKTWEQERARKQMVKNREFLNSLN. This peptide increases cAMP production in Malpighian tubules of T. molitor. The amin...

Descripció completa

Guardat en:
Dades bibliogràfiques
Autors principals: Furuya, K, Schegg, K M, Wang, H, King, D S, Schooley, D A
Format: Artigo
Idioma:Inglês
Publicat: 1995
Matèries:
Research Article
Accés en línia:https://ncbi.nlm.nih.gov/pmc/articles/PMC40349/
https://ncbi.nlm.nih.gov/pubmed/8618894
Etiquetes: Afegir etiqueta
Sense etiquetes, Sigues el primer a etiquetar aquest registre!

Ítems similars