Mechanistic Insight into CM(18)-Tat(11) Peptide Membrane-Perturbing Action by Whole-Cell Patch-Clamp Recording

The membrane-destabilization properties of the recently-introduced endosomolytic CM(18)-Tat(11) hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1–7 of cecropin-A, 2–12 of melittin, and 47–57 of HIV-1 Tat protein) are investigated in CHO-K1 cells by using the whole-cell configuration of the...

Szczegółowa specyfikacja

Zapisane w:
Opis bibliograficzny
Wydane w:Molecules
Główni autorzy: Fasoli, Anna, Salomone, Fabrizio, Benedusi, Mascia, Boccardi, Claudia, Rispoli, Giorgio, Beltram, Fabio, Cardarelli, Francesco
Format: Artigo
Język:Inglês
Wydane: MDPI 2014
Hasła przedmiotowe:
Communication
Dostęp online:https://ncbi.nlm.nih.gov/pmc/articles/PMC6271366/
https://ncbi.nlm.nih.gov/pubmed/24991756
https://ncbi.nlm.nih.govhttp://dx.doi.org/10.3390/molecules19079228
Etykiety: Dodaj etykietę
Nie ma etykietki, Dołącz pierwszą etykiete!

Podobne zapisy