Mechanistic Insight into CM(18)-Tat(11) Peptide Membrane-Perturbing Action by Whole-Cell Patch-Clamp Recording

The membrane-destabilization properties of the recently-introduced endosomolytic CM(18)-Tat(11) hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1–7 of cecropin-A, 2–12 of melittin, and 47–57 of HIV-1 Tat protein) are investigated in CHO-K1 cells by using the whole-cell configuration of the...

ver descrição completa

Na minha lista:
Detalhes bibliográficos
Publicado no:Molecules
Main Authors: Fasoli, Anna, Salomone, Fabrizio, Benedusi, Mascia, Boccardi, Claudia, Rispoli, Giorgio, Beltram, Fabio, Cardarelli, Francesco
Formato: Artigo
Idioma:Inglês
Publicado em: MDPI 2014
Assuntos:
Communication
Acesso em linha:https://ncbi.nlm.nih.gov/pmc/articles/PMC6271366/
https://ncbi.nlm.nih.gov/pubmed/24991756
https://ncbi.nlm.nih.govhttp://dx.doi.org/10.3390/molecules19079228
Tags: Adicionar Tag
Sem tags, seja o primeiro a adicionar uma tag!

Registos relacionados