טוען...
Mechanistic Insight into CM(18)-Tat(11) Peptide Membrane-Perturbing Action by Whole-Cell Patch-Clamp Recording
The membrane-destabilization properties of the recently-introduced endosomolytic CM(18)-Tat(11) hybrid peptide (KWKLFKKIGAVLKVLTTG-YGRKKRRQRRR, residues 1–7 of cecropin-A, 2–12 of melittin, and 47–57 of HIV-1 Tat protein) are investigated in CHO-K1 cells by using the whole-cell configuration of the...
שמור ב:
| הוצא לאור ב: | Molecules |
|---|---|
| Main Authors: | , , , , , , |
| פורמט: | Artigo |
| שפה: | Inglês |
| יצא לאור: |
MDPI
2014
|
| נושאים: | |
| גישה מקוונת: | https://ncbi.nlm.nih.gov/pmc/articles/PMC6271366/ https://ncbi.nlm.nih.gov/pubmed/24991756 https://ncbi.nlm.nih.govhttp://dx.doi.org/10.3390/molecules19079228 |
| תגים: |
הוספת תג
אין תגיות, היה/י הראשונ/ה לתייג את הרשומה!
|