Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first seque...

Full description

Saved in:
Bibliographic Details
Main Authors: Van Beeumen, J. J., Devreese, B. V., Van Bun, S. M., Hoff, W. D., Hellingwerf, K. J., Meyer, T. E., McRee, D. E., Cusanovich, M. A.
Format: Artigo
Language:Inglês
Published: Cold Spring Harbor Laboratory Press 1993
Subjects:
Research Article
Online Access:https://ncbi.nlm.nih.gov/pmc/articles/PMC2142427/
https://ncbi.nlm.nih.gov/pubmed/8358295
Tags: Add Tag
No Tags, Be the first to tag this record!

Similar Items