Caricamento...

Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first seque...

Descrizione completa

Salvato in:
Dettagli Bibliografici
Autori principali: Van Beeumen, J. J., Devreese, B. V., Van Bun, S. M., Hoff, W. D., Hellingwerf, K. J., Meyer, T. E., McRee, D. E., Cusanovich, M. A.
Natura: Artigo
Lingua:Inglês
Pubblicazione: Cold Spring Harbor Laboratory Press 1993
Soggetti:
Accesso online:https://ncbi.nlm.nih.gov/pmc/articles/PMC2142427/
https://ncbi.nlm.nih.gov/pubmed/8358295
Tags: Aggiungi Tag
Nessun Tag, puoi essere il primo ad aggiungerne! !